![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (4 species) |
![]() | Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [158875] (1 PDB entry) |
![]() | Domain d1zvsd1: 1zvs D:182-278 [144775] Other proteins in same PDB: d1zvsa2, d1zvsb1, d1zvsd2, d1zvse1 automatically matched to 1ZVS A:182-278 |
PDB Entry: 1zvs (more details), 2.8 Å
SCOP Domain Sequences for d1zvsd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zvsd1 b.1.1.2 (D:182-278) Class I MHC, alpha-3 domain {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} tdppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgeeqrytchvqheglpkphtlkwephh
Timeline for d1zvsd1:
![]() Domains from other chains: (mouse over for more information) d1zvsa1, d1zvsa2, d1zvsb1, d1zvse1 |