Lineage for d1zvsd1 (1zvs D:182-278)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784408Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 784783Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [158875] (1 PDB entry)
  8. 784785Domain d1zvsd1: 1zvs D:182-278 [144775]
    Other proteins in same PDB: d1zvsa2, d1zvsb1, d1zvsd2, d1zvse1
    automatically matched to 1ZVS A:182-278

Details for d1zvsd1

PDB Entry: 1zvs (more details), 2.8 Å

PDB Description: Crystal structure of the first class MHC mamu and Tat-Tl8 complex
PDB Compounds: (D:) MHC class I antigen

SCOP Domain Sequences for d1zvsd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvsd1 b.1.1.2 (D:182-278) Class I MHC, alpha-3 domain {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
tdppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpkphtlkwephh

SCOP Domain Coordinates for d1zvsd1:

Click to download the PDB-style file with coordinates for d1zvsd1.
(The format of our PDB-style files is described here.)

Timeline for d1zvsd1: