SCOPe 2.05: Domain d1zvha1: 1zvh A:2-124

Lineage for d1zvha1 (1zvh A:2-124)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)

7. Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
   SQ NA # camelid antibody

8. Domain d1zvha1: 1zvh A:2-124 [144772]
   Other proteins in same PDB: d1zvhl_

Details for d1zvha1

PDB Entry: 1zvh, 1.5 Å

PDB Description: crystal structure of the vhh domain d2-l24 in complex with hen egg white lysozyme

PDB Compounds: (A:) immunoglobulin heavy chain antibody variable domain

SCOPe Domain Sequences for d1zvha1:

Sequence; same for both SEQRES and ATOM records:

>d1zvha1 b.1.1.1 (A:2-124) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqaggslrlscaasgyiasinylgwfrqapgkeregvaavspaggtpyya
dsvkgrftvsldnaentvylqmnslkpedtalyycaaarqgwyiplnsygynywgqgtqv
tvs

Timeline for d1zvha1:

• d1zvha1 first appeared in SCOP 1.75
  
• d1zvha1 appears in SCOPe 2.04
  
• d1zvha1 appears in SCOPe 2.06
  
• d1zvha1 appears in the current release, SCOPe 2.08