SCOPe 2.06: Domain d1zv5a1: 1zv5 A:2-120

Lineage for d1zv5a1 (1zv5 A:2-120)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)

7. Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
   SQ NA # camelid antibody

8. Domain d1zv5a1: 1zv5 A:2-120 [144771]
   Other proteins in same PDB: d1zv5l_
   complexed with po4

Details for d1zv5a1

PDB Entry: 1zv5, 2 Å

PDB Description: crystal structure of the variable domain of the camelid heavy-chain antibody d2-l29 in complex with hen egg white lysozyme

PDB Compounds: (A:) immunoglobulin heavy chain antibody variable domain

SCOPe Domain Sequences for d1zv5a1:

Sequence; same for both SEQRES and ATOM records:

>d1zv5a1 b.1.1.1 (A:2-120) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqageslrlscaasgvtyknycigwfrqapgkdregvvfinsdggityya
dsvkgrftisqdnakntvylqmnslkpedtasyycaagyrnygqcatrywgqgtqvtvs

Timeline for d1zv5a1:

• d1zv5a1 first appeared in SCOP 1.75
  
• d1zv5a1 appears in SCOPe 2.05
  
• d1zv5a1 appears in SCOPe 2.07
  
• d1zv5a1 appears in the current release, SCOPe 2.08