Lineage for d1zt7a2 (1zt7 A:1-176)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2545257Species Mouse (Mus musculus), H-2KK [TaxId:10090] [160075] (2 PDB entries)
    Uniprot P04223 22-197
  8. 2545259Domain d1zt7a2: 1zt7 A:1-176 [144768]
    Other proteins in same PDB: d1zt7a1, d1zt7b1, d1zt7c1, d1zt7d1
    automatically matched to 1ZT1 A:1-176

Details for d1zt7a2

PDB Entry: 1zt7 (more details), 3 Å

PDB Description: crystal structure of class i mhc h-2kk in complex with a nonapeptide
PDB Compounds: (A:) H-2 class I histocompatibility antigen, K-K alpha chain

SCOPe Domain Sequences for d1zt7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zt7a2 d.19.1.1 (A:1-176) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KK [TaxId: 10090]}
gphslryfhtavsrpglgkprfisvgyvddtqfvrfdsdaenpryeprvrwmeqvepeyw
erntqiakgneqifrvnlrtalryynqsaggshtfqrmygcevgsdwrllrgyeqyaydg
cdyialnedlktwtaadmaalitkhkweqagdaerdraylegtcvewlrrylqlgn

SCOPe Domain Coordinates for d1zt7a2:

Click to download the PDB-style file with coordinates for d1zt7a2.
(The format of our PDB-style files is described here.)

Timeline for d1zt7a2: