SCOPe 2.04: Domain d1zt4c2: 1zt4 C:4-183

Lineage for d1zt4c2 (1zt4 C:4-183)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (11 PDB entries)

8. Domain d1zt4c2: 1zt4 C:4-183 [144766]
   Other proteins in same PDB: d1zt4a1, d1zt4b_, d1zt4c1, d1zt4d_
   automated match to d3hujc1
   complexed with agh

Details for d1zt4c2

PDB Entry: 1zt4, 3 Å

PDB Description: the crystal structure of human cd1d with and without alpha- galactosylceramide

PDB Compounds: (C:) T-cell surface glycoprotein CD1d

SCOPe Domain Sequences for d1zt4c2:

Sequence; same for both SEQRES and ATOM records:

>d1zt4c2 d.19.1.1 (C:4-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
pqrlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqw
etlqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdi
lsfqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

Timeline for d1zt4c2:

• d1zt4c2 first appeared in SCOP 1.75
  
• d1zt4c2 appears in SCOPe 2.03
  
• d1zt4c2 appears in SCOPe 2.05
  
• d1zt4c2 appears in the current release, SCOPe 2.08