Lineage for d1zt4c1 (1zt4 C:184-277)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1291386Protein CD1, alpha-3 domain [88615] (5 species)
  7. 1291410Species Human (Homo sapiens), CD1d [TaxId:9606] [158876] (2 PDB entries)
    Uniprot P15813 202-295
  8. 1291414Domain d1zt4c1: 1zt4 C:184-277 [144765]
    Other proteins in same PDB: d1zt4a2, d1zt4b1, d1zt4c2, d1zt4d1
    automatically matched to 1ZT4 A:184-277
    complexed with agh

Details for d1zt4c1

PDB Entry: 1zt4 (more details), 3 Å

PDB Description: the crystal structure of human cd1d with and without alpha- galactosylceramide
PDB Compounds: (C:) T-cell surface glycoprotein CD1d

SCOPe Domain Sequences for d1zt4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zt4c1 b.1.1.2 (C:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1d [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw

SCOPe Domain Coordinates for d1zt4c1:

Click to download the PDB-style file with coordinates for d1zt4c1.
(The format of our PDB-style files is described here.)

Timeline for d1zt4c1: