| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein CD1, alpha-3 domain [88615] (4 species) |
| Species Human (Homo sapiens), CD1d [TaxId:9606] [158876] (2 PDB entries) Uniprot P15813 202-295 |
| Domain d1zt4c1: 1zt4 C:184-277 [144765] Other proteins in same PDB: d1zt4a2, d1zt4b1, d1zt4c2, d1zt4d1 automatically matched to 1ZT4 A:184-277 complexed with agh |
PDB Entry: 1zt4 (more details), 3 Å
SCOPe Domain Sequences for d1zt4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zt4c1 b.1.1.2 (C:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1d [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw
Timeline for d1zt4c1:
View in 3DDomains from other chains: (mouse over for more information) d1zt4a1, d1zt4a2, d1zt4b1, d1zt4d1 |