Lineage for d1zr0d_ (1zr0 D:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259419Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2259420Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2259421Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2259597Protein Tissue factor pathway inhibitor [57368] (1 species)
  7. 2259598Species Human (Homo sapiens) [TaxId:9606] [57369] (4 PDB entries)
  8. 2259600Domain d1zr0d_: 1zr0 D: [144748]
    Other proteins in same PDB: d1zr0a_, d1zr0c_
    automated match to d1zr0b1
    complexed with ca

Details for d1zr0d_

PDB Entry: 1zr0 (more details), 1.8 Å

PDB Description: Crystal Structure of Kunitz Domain 1 of Tissue Factor Pathway Inhibitor-2 with Bovine Trypsin
PDB Compounds: (D:) Tissue factor pathway inhibitor 2

SCOPe Domain Sequences for d1zr0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zr0d_ g.8.1.1 (D:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]}
ptgnnaeicllpldygpcralllryyydrytqscrqflyggcegnannfytweacddacw
rie

SCOPe Domain Coordinates for d1zr0d_:

Click to download the PDB-style file with coordinates for d1zr0d_.
(The format of our PDB-style files is described here.)

Timeline for d1zr0d_: