Lineage for d1zlib1 (1zli B:1-37)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032898Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 3032899Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 3033045Family g.9.1.3: Tick carboxypeptidase inhibitor-like [161135] (2 proteins)
  6. 3033046Protein Carboxypeptidase inhibitor [161136] (1 species)
    consists of two structurally similar to beta-defensin domains
  7. 3033047Species Tick (Rhipicephalus bursa) [TaxId:67831] [161137] (4 PDB entries)
    Uniprot Q5EPH2 23-59! Uniprot Q5EPH2 60-96
  8. 3033052Domain d1zlib1: 1zli B:1-37 [144744]
    Other proteins in same PDB: d1zlia1
    automated match to d1zlhb1
    complexed with zn

Details for d1zlib1

PDB Entry: 1zli (more details), 2.09 Å

PDB Description: crystal structure of the tick carboxypeptidase inhibitor in complex with human carboxypeptidase b
PDB Compounds: (B:) carboxypeptidase inhibitor

SCOPe Domain Sequences for d1zlib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zlib1 g.9.1.3 (B:1-37) Carboxypeptidase inhibitor {Tick (Rhipicephalus bursa) [TaxId: 67831]}
necvskgfgclpqsdcpqearlsyggcstvccdlskl

SCOPe Domain Coordinates for d1zlib1:

Click to download the PDB-style file with coordinates for d1zlib1.
(The format of our PDB-style files is described here.)

Timeline for d1zlib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zlib2
View in 3D
Domains from other chains:
(mouse over for more information)
d1zlia1