SCOPe 2.05: Domain d1zlhb2: 1zlh B:38-74

Lineage for d1zlhb2 (1zlh B:38-74)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.9: Defensin-like [57391] (1 superfamily)
   Disulfide-rich fold, nearly all-beta

4. Superfamily g.9.1: Defensin-like [57392] (3 families)

5. Family g.9.1.3: Tick carboxypeptidase inhibitor-like [161135] (2 proteins)

6. Protein Carboxypeptidase inhibitor [161136] (1 species)
   consists of two structurally similar to beta-defensin domains

7. Species Tick (Rhipicephalus bursa) [TaxId:67831] [161137] (4 PDB entries)
   Uniprot Q5EPH2 23-59! Uniprot Q5EPH2 60-96

8. Domain d1zlhb2: 1zlh B:38-74 [144743]
   Other proteins in same PDB: d1zlha_
   complexed with zn

Details for d1zlhb2

PDB Entry: 1zlh, 1.7 Å

PDB Description: crystal structure of the tick carboxypeptidase inhibitor in complex with bovine carboxypeptidase a

PDB Compounds: (B:) carboxypeptidase inhibitor

SCOPe Domain Sequences for d1zlhb2:

Sequence; same for both SEQRES and ATOM records:

>d1zlhb2 g.9.1.3 (B:38-74) Carboxypeptidase inhibitor {Tick (Rhipicephalus bursa) [TaxId: 67831]}
tgckgkggecnpldrqckelqaesascgkgqkccvwl

Timeline for d1zlhb2:

• d1zlhb2 first appeared in SCOP 1.75
  
• d1zlhb2 appears in SCOPe 2.04
  
• d1zlhb2 appears in SCOPe 2.06
  
• d1zlhb2 appears in the current release, SCOPe 2.08