Class g: Small proteins [56992] (92 folds) |
Fold g.9: Defensin-like [57391] (1 superfamily) Disulfide-rich fold, nearly all-beta |
Superfamily g.9.1: Defensin-like [57392] (3 families) |
Family g.9.1.3: Tick carboxypeptidase inhibitor-like [161135] (2 proteins) |
Protein Carboxypeptidase inhibitor [161136] (1 species) consists of two structurally similar to beta-defensin domains |
Species Tick (Rhipicephalus bursa) [TaxId:67831] [161137] (4 PDB entries) Uniprot Q5EPH2 23-59! Uniprot Q5EPH2 60-96 |
Domain d1zlhb2: 1zlh B:38-74 [144743] Other proteins in same PDB: d1zlha_ complexed with zn |
PDB Entry: 1zlh (more details), 1.7 Å
SCOPe Domain Sequences for d1zlhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zlhb2 g.9.1.3 (B:38-74) Carboxypeptidase inhibitor {Tick (Rhipicephalus bursa) [TaxId: 67831]} tgckgkggecnpldrqckelqaesascgkgqkccvwl
Timeline for d1zlhb2: