![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.6: Sensory domain-like [103190] (3 families) ![]() alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
![]() | Family d.110.6.3: LuxQ-periplasmic domain-like [160679] (1 protein) Pfam PF09308; two-domain arrangement similar to the YkuI C-terminal domain-like |
![]() | Protein Autoinducer 2 sensor kinase/phosphatase LuxQ [160680] (1 species) |
![]() | Species Vibrio harveyi [TaxId:669] [160681] (3 PDB entries) Uniprot P54302 51-271! Uniprot P54302 52-270 |
![]() | Domain d1zhhb1: 1zhh B:51-271 [144740] Other proteins in same PDB: d1zhha_ the second PAS-domain is partly disordered in the crystals complexed with nhe |
PDB Entry: 1zhh (more details), 1.94 Å
SCOPe Domain Sequences for d1zhhb1:
Sequence, based on SEQRES records: (download)
>d1zhhb1 d.110.6.3 (B:51-271) Autoinducer 2 sensor kinase/phosphatase LuxQ {Vibrio harveyi [TaxId: 669]} rtkqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpsh tpefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvr rvpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepy nvadvlqrkssdkrldkllvietpivvnavttelclltvqd
>d1zhhb1 d.110.6.3 (B:51-271) Autoinducer 2 sensor kinase/phosphatase LuxQ {Vibrio harveyi [TaxId: 669]} rtkqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpsh tpefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvr rvpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepy nvadvlvietpivvnavttelclltvqd
Timeline for d1zhhb1: