![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
![]() | Superfamily d.37.1: CBS-domain pair [54631] (1 family) ![]() |
![]() | Family d.37.1.1: CBS-domain pair [54632] (20 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
![]() | Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species) contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals |
![]() | Species Streptococcus pyogenes [TaxId:1314] [54635] (1 PDB entry) |
![]() | Domain d1zfja4: 1zfj A:95-220 [144739] Other proteins in same PDB: d1zfja1 complexed with imp |
PDB Entry: 1zfj (more details), 1.9 Å
SCOP Domain Sequences for d1zfja4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} ngviidpffltpehkvseaeelmqryrisgvpivetlanrklvgiitnrdmrfisdynap isehmtsehlvtaavgtdletaerilhehrieklplvdnsgrlsglitikdiekviefph aakdef
Timeline for d1zfja4: