Lineage for d1z9sb1 (1z9s B:1-149)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040518Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2040523Family b.2.3.2: Pilus subunits [49405] (10 proteins)
  6. 2040528Protein F1 capsule antigen Caf1 [89213] (1 species)
  7. 2040529Species Yersinia pestis [TaxId:632] [89214] (6 PDB entries)
  8. 2040535Domain d1z9sb1: 1z9s B:1-149 [144738]
    Other proteins in same PDB: d1z9sa1, d1z9sa2

Details for d1z9sb1

PDB Entry: 1z9s (more details), 2.2 Å

PDB Description: Crystal Structure of the native chaperone:subunit:subunit Caf1M:Caf1:Caf1 complex
PDB Compounds: (B:) F1 capsule antigen

SCOPe Domain Sequences for d1z9sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z9sb1 b.2.3.2 (B:1-149) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
adltasttatatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
ffvrsigskggklaagkytdavtvtvsnq

SCOPe Domain Coordinates for d1z9sb1:

Click to download the PDB-style file with coordinates for d1z9sb1.
(The format of our PDB-style files is described here.)

Timeline for d1z9sb1: