![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.2: Pilus subunits [49405] (11 proteins) |
![]() | Protein F1 capsule antigen Caf1 [89213] (1 species) |
![]() | Species Yersinia pestis [TaxId:632] [89214] (6 PDB entries) |
![]() | Domain d1z9sb1: 1z9s B:1-149 [144738] Other proteins in same PDB: d1z9sa1, d1z9sa2 |
PDB Entry: 1z9s (more details), 2.2 Å
SCOPe Domain Sequences for d1z9sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z9sb1 b.2.3.2 (B:1-149) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]} adltasttatatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd ffvrsigskggklaagkytdavtvtvsnq
Timeline for d1z9sb1: