Lineage for d1z5sc1 (1z5s C:432-587)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340360Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) (S)
    automatically mapped to Pfam PF07834
  5. 2340361Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins)
  6. 2340362Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species)
  7. 2340363Species Human (Homo sapiens) [TaxId:9606] [158788] (9 PDB entries)
    Uniprot P46060 431-587! Uniprot P46060 432-587
  8. 2340369Domain d1z5sc1: 1z5s C:432-587 [144737]
    Other proteins in same PDB: d1z5sa_, d1z5sb_

Details for d1z5sc1

PDB Entry: 1z5s (more details), 3.01 Å

PDB Description: crystal structure of a complex between ubc9, sumo-1, rangap1 and nup358/ranbp2
PDB Compounds: (C:) ran gtpase-activating protein 1

SCOPe Domain Sequences for d1z5sc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5sc1 a.118.12.1 (C:432-587) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
advstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmavq
davdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdyf
pkalaplllafvtkpnsalescsfarhsllqtlykv

SCOPe Domain Coordinates for d1z5sc1:

Click to download the PDB-style file with coordinates for d1z5sc1.
(The format of our PDB-style files is described here.)

Timeline for d1z5sc1: