Lineage for d1z3gm1 (1z3g M:1-106)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1511401Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511917Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (40 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 1511978Domain d1z3gm1: 1z3g M:1-106 [144735]
    Other proteins in same PDB: d1z3gh1, d1z3gi1, d1z3gl2, d1z3gm2
    automatically matched to 1Z3G L:1-106

Details for d1z3gm1

PDB Entry: 1z3g (more details), 3.3 Å

PDB Description: crystal structure of complex between pvs25 and fab fragment of malaria transmission blocking antibody 2a8
PDB Compounds: (M:) 2A8 Fab Light Chain

SCOPe Domain Sequences for d1z3gm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z3gm1 b.1.1.1 (M:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qivltqspaimsaspgekvtmtcsasssvsymnwyqqksgtspkrwiydtsklasgvpah
frgsgsgtsysltisgmeaedaatyycqqwssnpptfgsgtklein

SCOPe Domain Coordinates for d1z3gm1:

Click to download the PDB-style file with coordinates for d1z3gm1.
(The format of our PDB-style files is described here.)

Timeline for d1z3gm1: