Lineage for d1z2bd2 (1z2b D:246-438)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865651Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 865803Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) (S)
  5. 865804Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
  6. 865861Protein Tubulin beta-subunit [55313] (2 species)
  7. 865862Species Cow (Bos taurus) [TaxId:9913] [64322] (7 PDB entries)
    Uniprot P02554
  8. 865868Domain d1z2bd2: 1z2b D:246-438 [144732]
    Other proteins in same PDB: d1z2ba1, d1z2ba2, d1z2bb1, d1z2bc1, d1z2bc2, d1z2bd1, d1z2be1
    automatically matched to 1Z2B B:246-438
    complexed with cn2, gdp, gtp, mg, vlb

Details for d1z2bd2

PDB Entry: 1z2b (more details), 4.1 Å

PDB Description: Tubulin-colchicine-vinblastine: stathmin-like domain complex
PDB Compounds: (D:) Tubulin beta chain

SCOP Domain Sequences for d1z2bd2:

Sequence, based on SEQRES records: (download)

>d1z2bd2 d.79.2.1 (D:246-438) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records): (download)

>d1z2bd2 d.79.2.1 (D:246-438) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsltvpeltqqmfdsknmmaacdprhgryl
tvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfigns
taiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda

SCOP Domain Coordinates for d1z2bd2:

Click to download the PDB-style file with coordinates for d1z2bd2.
(The format of our PDB-style files is described here.)

Timeline for d1z2bd2: