![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein Tubulin beta-subunit [52496] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [63990] (5 PDB entries) Uniprot P02550 ! Uniprot P02554 |
![]() | Domain d1z2bd1: 1z2b D:2-245 [144731] Other proteins in same PDB: d1z2ba1, d1z2ba2, d1z2bb2, d1z2bc1, d1z2bc2, d1z2bd2, d1z2be1 automatically matched to 1Z2B B:2-245 complexed with cn2, gdp, gtp, mg, vlb |
PDB Entry: 1z2b (more details), 4.1 Å
SCOPe Domain Sequences for d1z2bd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z2bd1 c.32.1.1 (D:2-245) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]} reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve pynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttclr fp
Timeline for d1z2bd1: