Lineage for d1z2bd1 (1z2b D:2-245)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828655Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 828656Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) (S)
  5. 828657Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)
  6. 828713Protein Tubulin beta-subunit [52496] (2 species)
  7. 828714Species Cow (Bos taurus) [TaxId:9913] [63990] (7 PDB entries)
    Uniprot P02550
    Uniprot P02554
    Uniprot P02550 ! Uniprot P02554
  8. 828721Domain d1z2bd1: 1z2b D:2-245 [144731]
    Other proteins in same PDB: d1z2ba1, d1z2ba2, d1z2bb2, d1z2bc1, d1z2bc2, d1z2bd2, d1z2be1
    automatically matched to 1Z2B B:2-245
    complexed with cn2, gdp, gtp, mg, vlb

Details for d1z2bd1

PDB Entry: 1z2b (more details), 4.1 Å

PDB Description: Tubulin-colchicine-vinblastine: stathmin-like domain complex
PDB Compounds: (D:) Tubulin beta chain

SCOP Domain Sequences for d1z2bd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z2bd1 c.32.1.1 (D:2-245) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

SCOP Domain Coordinates for d1z2bd1:

Click to download the PDB-style file with coordinates for d1z2bd1.
(The format of our PDB-style files is described here.)

Timeline for d1z2bd1: