Lineage for d1z2bb1 (1z2b B:2-245)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121563Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2121564Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2121565Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2121663Protein Tubulin beta-subunit [52496] (2 species)
  7. 2121664Species Cow (Bos taurus) [TaxId:9913] [63990] (11 PDB entries)
    Uniprot P02550 ! Uniprot P02554
  8. 2121680Domain d1z2bb1: 1z2b B:2-245 [144727]
    Other proteins in same PDB: d1z2ba1, d1z2ba2, d1z2bb2, d1z2bc1, d1z2bc2, d1z2bd2, d1z2be1, d1z2be2
    complexed with cn2, gdp, gtp, mg, vlb

Details for d1z2bb1

PDB Entry: 1z2b (more details), 4.1 Å

PDB Description: Tubulin-colchicine-vinblastine: stathmin-like domain complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d1z2bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z2bb1 c.32.1.1 (B:2-245) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

SCOPe Domain Coordinates for d1z2bb1:

Click to download the PDB-style file with coordinates for d1z2bb1.
(The format of our PDB-style files is described here.)

Timeline for d1z2bb1: