Lineage for d1z2ba2 (1z2b A:246-437)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865651Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 865803Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) (S)
  5. 865804Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
  6. 865843Protein Tubulin alpha-subunit [55311] (3 species)
  7. 865844Species Cow (Bos taurus) [TaxId:9913] [64321] (5 PDB entries)
    Uniprot P02550
  8. 865849Domain d1z2ba2: 1z2b A:246-437 [144726]
    Other proteins in same PDB: d1z2ba1, d1z2bb1, d1z2bb2, d1z2bc1, d1z2bd1, d1z2bd2, d1z2be1
    complexed with cn2, gdp, gtp, mg, vlb

Details for d1z2ba2

PDB Entry: 1z2b (more details), 4.1 Å

PDB Description: Tubulin-colchicine-vinblastine: stathmin-like domain complex
PDB Compounds: (A:) Tubulin alpha chain

SCOP Domain Sequences for d1z2ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z2ba2 d.79.2.1 (A:246-437) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgi

SCOP Domain Coordinates for d1z2ba2:

Click to download the PDB-style file with coordinates for d1z2ba2.
(The format of our PDB-style files is described here.)

Timeline for d1z2ba2: