Lineage for d1z2ba1 (1z2b A:2-245)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843633Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1843634Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1843635Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1843713Protein Tubulin alpha-subunit [52494] (3 species)
  7. 1843714Species Cow (Bos taurus) [TaxId:9913] [63989] (4 PDB entries)
  8. 1843718Domain d1z2ba1: 1z2b A:2-245 [144725]
    Other proteins in same PDB: d1z2ba2, d1z2bb1, d1z2bb2, d1z2bc2, d1z2bd1, d1z2bd2, d1z2be1
    complexed with cn2, gdp, gtp, mg, vlb

Details for d1z2ba1

PDB Entry: 1z2b (more details), 4.1 Å

PDB Description: Tubulin-colchicine-vinblastine: stathmin-like domain complex
PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d1z2ba1:

Sequence, based on SEQRES records: (download)

>d1z2ba1 c.32.1.1 (A:2-245) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]}
recisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagkh
vpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldr
irkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstav
vepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitas
lrfd

Sequence, based on observed residues (ATOM records): (download)

>d1z2ba1 c.32.1.1 (A:2-245) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]}
recisihvgqagvqignacwelyclehgiqpdgqmpdsfntffsetgagkhvpravfvdl
eptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkladqct
glqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepynsilt
thttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfd

SCOPe Domain Coordinates for d1z2ba1:

Click to download the PDB-style file with coordinates for d1z2ba1.
(The format of our PDB-style files is described here.)

Timeline for d1z2ba1: