SCOPe 2.08: Domain d1yyfc1: 1yyf C:2-181

Lineage for d1yyfc1 (1yyf C:2-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein HslV (ClpQ) protease [56258] (4 species)
   dodecameric prokaryotic homologue of proteasome

7. Species Bacillus subtilis [TaxId:1423] [160845] (2 PDB entries)
   Uniprot P39070 2-181

8. Domain d1yyfc1: 1yyf C:2-181 [144719]
   Other proteins in same PDB: d1yyfa1, d1yyfb1
   complexed with adp

Details for d1yyfc1

PDB Entry: 1yyf, 4.16 Å

PDB Description: Correction of X-ray Intensities from an HslV-HslU co-crystal containing lattice translocation defects

PDB Compounds: (C:) ATP-dependent protease hslv

SCOPe Domain Sequences for d1yyfc1:

Sequence; same for both SEQRES and ATOM records:

>d1yyfc1 d.153.1.4 (C:2-181) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]}
ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele

Timeline for d1yyfc1:

• d1yyfc1 first appeared in SCOP 1.75
  
• d1yyfc1 appears in SCOPe 2.07