Lineage for d1yqvh_ (1yqv H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (23 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (610 PDB entries)
  8. 2744348Domain d1yqvh_: 1yqv H: [144718]
    Other proteins in same PDB: d1yqvl1, d1yqvl2, d1yqvy_
    automated match to d6shgh_

Details for d1yqvh_

PDB Entry: 1yqv (more details), 1.7 Å

PDB Description: the crystal structure of the antibody fab hyhel5 complex with lysozyme at 1.7a resolution
PDB Compounds: (H:) HyHEL-5 Antibody Heavy Chain

SCOPe Domain Sequences for d1yqvh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yqvh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelmkpgasvkisckasgytfsdywiewvkqrpghglewigeilpgsgstny
herfkgkatftadtssstaymqlnsltsedsgvyyclhgnydfdgwgqgttltvssaktt
ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
sssvtvpsstwpsetvtcnvahpasstkvdkkild

SCOPe Domain Coordinates for d1yqvh_:

Click to download the PDB-style file with coordinates for d1yqvh_.
(The format of our PDB-style files is described here.)

Timeline for d1yqvh_: