SCOPe 2.08: Domain d1yqvh_: 1yqv H:

Lineage for d1yqvh_ (1yqv H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d1yqvh_: 1yqv H: [144718]
   Other proteins in same PDB: d1yqvl1, d1yqvl2, d1yqvy_
   automated match to d6shgh_

Details for d1yqvh_

PDB Entry: 1yqv, 1.7 Å

PDB Description: the crystal structure of the antibody fab hyhel5 complex with lysozyme at 1.7a resolution

PDB Compounds: (H:) HyHEL-5 Antibody Heavy Chain

SCOPe Domain Sequences for d1yqvh_:

Sequence; same for both SEQRES and ATOM records:

>d1yqvh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelmkpgasvkisckasgytfsdywiewvkqrpghglewigeilpgsgstny
herfkgkatftadtssstaymqlnsltsedsgvyyclhgnydfdgwgqgttltvssaktt
ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
sssvtvpsstwpsetvtcnvahpasstkvdkkild

Timeline for d1yqvh_:

• d1yqvh_ first appeared in SCOP 1.75, called d1yqvh1
  
• d1yqvh_ was called d1yqvh1 in SCOPe 2.07