Lineage for d1yq9h1 (1yq9 H:7-536)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. Family e.18.1.1: Nickel-iron hydrogenase, large subunit [56763] (2 proteins)
  6. Protein Nickel-iron hydrogenase, large subunit [56764] (5 species)
  7. Species Desulfovibrio gigas [TaxId:879] [56765] (3 PDB entries)
  8. Domain d1yq9h1: 1yq9 H:7-536 [144716]
    Other proteins in same PDB: d1yq9a_, d1yq9b_, d1yq9i_
    complexed with f3s, fco, gol, h2s, mg, ni, per, sf4

Details for d1yq9h1

PDB Entry: 1yq9 (more details), 2.3499999999999996 Å

PDB Description: structure of the unready oxidized form of [nife] hydrogenase
PDB Compounds: (H:) Periplasmic [NiFe] hydrogenase Large subunit

SCOPe Domain Sequences for d1yq9h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yq9h1 e.18.1.1 (H:7-536) Nickel-iron hydrogenase, large subunit {Desulfovibrio gigas [TaxId: 879]}
nkivvdpitrieghlrieveveggkiknawsmstlfrglemilkgrdprdaqhftqracg
vctyvhalasvravdncvgvkipenatlmrnltmgaqymhdhlvhfyhlhaldwvnvana
lnadpakaarlandlsprkttteslkavqakvkalvesgqlgiftnayflgghpayvlpa
evdliatahylealrvqvkaaramaifgaknphtqftvvggctnydslrperiaefrkly
kevrefieqvyitdllavagfyknwagigktsnfltcgefptdeydlnsrytpqgviwgn
dlskvddfnpdlieehvkyswyegadahhpykgvtkpkwtefhgedryswmkaprykgea
fevgplasvlvayakkheptvkavdlvlktlgvgpealfstlgrtaargiqcltaaqeve
vwldkleanvkagkddlytdwqyptesqgvgfvnaprgmlshwivqrggkienfqlvvps
twnlgprcaegklsaveqaligtpiadpkrpveilrtvhsydpciacgvh

SCOPe Domain Coordinates for d1yq9h1 are not available.

Timeline for d1yq9h1:

Domains from other chains:
(mouse over for more information)
d1yq9a_, d1yq9b_, d1yq9i_