SCOPe 2.07: Domain d1ypzh2: 1ypz H:121-230

Lineage for d1ypzh2 (1ypz H:121-230)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), gamma-chain [TaxId:9606] [63661] (2 PDB entries)

8. Domain d1ypzh2: 1ypz H:121-230 [144715]
   Other proteins in same PDB: d1ypza1, d1ypza2, d1ypzb1, d1ypzc1, d1ypzc2, d1ypzd1, d1ypze1, d1ypzf1, d1ypzg1, d1ypzh1
   automatically matched to 1YPZ F:121-230

Details for d1ypzh2

PDB Entry: 1ypz, 3.4 Å

PDB Description: immune receptor

PDB Compounds: (H:) T-cell receptor gamma chain

SCOPe Domain Sequences for d1ypzh2:

Sequence; same for both SEQRES and ATOM records:

>d1ypzh2 b.1.1.2 (H:121-230) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]}
dkrldadispkptiflpsvaetnlhktgtylclleaffpdvirvywkekdgntildsqeg
dtlktndtymkfswltvperamgkehrcivkhennkggadqaiffpsikk

Timeline for d1ypzh2:

• d1ypzh2 first appeared in SCOP 1.75
  
• d1ypzh2 appears in SCOPe 2.06
  
• d1ypzh2 appears in the current release, SCOPe 2.08