Lineage for d1ypzh1 (1ypz H:1-120)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289755Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1289849Species Human (Homo sapiens), gamma-chain [TaxId:9606] [63651] (3 PDB entries)
  8. 1289863Domain d1ypzh1: 1ypz H:1-120 [144714]
    Other proteins in same PDB: d1ypza1, d1ypza2, d1ypzb1, d1ypzc1, d1ypzc2, d1ypzd1, d1ypze2, d1ypzf2, d1ypzg2, d1ypzh2
    automatically matched to 1YPZ F:1-120

Details for d1ypzh1

PDB Entry: 1ypz (more details), 3.4 Å

PDB Description: immune receptor
PDB Compounds: (H:) T-cell receptor gamma chain

SCOPe Domain Sequences for d1ypzh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ypzh1 b.1.1.1 (H:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]}
hgkleqpeisisrprdetaqisckvfiesfrsvtihwyrqkpnqglefllyvlatpthif
ldkeykkmeasknpsastsiltiysleeedeaiyycsygegssgfhkvfaegtklivips

SCOPe Domain Coordinates for d1ypzh1:

Click to download the PDB-style file with coordinates for d1ypzh1.
(The format of our PDB-style files is described here.)

Timeline for d1ypzh1: