Lineage for d1ypzg2 (1ypz G:120-207)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294107Protein T-cell antigen receptor [49125] (7 species)
  7. 1294184Species Human (Homo sapiens), delta-chain [TaxId:9606] [63662] (2 PDB entries)
  8. 1294190Domain d1ypzg2: 1ypz G:120-207 [144713]
    Other proteins in same PDB: d1ypza1, d1ypza2, d1ypzb1, d1ypzc1, d1ypzc2, d1ypzd1, d1ypze1, d1ypzf1, d1ypzg1, d1ypzh1
    automatically matched to 1YPZ E:120-207

Details for d1ypzg2

PDB Entry: 1ypz (more details), 3.4 Å

PDB Description: immune receptor
PDB Compounds: (G:) T cell receptor delta

SCOPe Domain Sequences for d1ypzg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ypzg2 b.1.1.2 (G:120-207) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]}
sqppakpsvfimkngtnvaclvkdfypkevtislrsskkivefdpaivispsgkysavkl
gqygdsnsvtcsvqhnsetvhstdfeaa

SCOPe Domain Coordinates for d1ypzg2:

Click to download the PDB-style file with coordinates for d1ypzg2.
(The format of our PDB-style files is described here.)

Timeline for d1ypzg2: