| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
| Species Human (Homo sapiens), delta-chain [TaxId:9606] [48938] (3 PDB entries) |
| Domain d1ypzg1: 1ypz G:1-119 [144712] Other proteins in same PDB: d1ypza1, d1ypza2, d1ypzb1, d1ypzc1, d1ypzc2, d1ypzd1, d1ypze2, d1ypzf2, d1ypzg2, d1ypzh2 automatically matched to 1YPZ E:1-119 |
PDB Entry: 1ypz (more details), 3.4 Å
SCOPe Domain Sequences for d1ypzg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ypzg1 b.1.1.1 (G:1-119) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]}
gdqveqspsalslhegtdsalrcnftttmrsvqwfrqnsrgslislfylasgtkengrlk
safdskerrystlhirdaqledsgtyfcaadtwhisegyelgtdklvfgqgtqvtvepk
Timeline for d1ypzg1: