SCOP 1.75: Domain d1ypzf1: 1ypz F:1-120

Lineage for d1ypzf1 (1ypz F:1-120)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), gamma-chain [TaxId:9606] [63651] (3 PDB entries)

8. Domain d1ypzf1: 1ypz F:1-120 [144710]
   Other proteins in same PDB: d1ypza1, d1ypza2, d1ypzb1, d1ypzc1, d1ypzc2, d1ypzd1, d1ypze2, d1ypzf2, d1ypzg2, d1ypzh2
   complexed with fuc, man, nag

Details for d1ypzf1

PDB Entry: 1ypz, 3.4 Å

PDB Description: immune receptor

PDB Compounds: (F:) T-cell receptor gamma chain

SCOP Domain Sequences for d1ypzf1:

Sequence; same for both SEQRES and ATOM records:

>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]}
hgkleqpeisisrprdetaqisckvfiesfrsvtihwyrqkpnqglefllyvlatpthif
ldkeykkmeasknpsastsiltiysleeedeaiyycsygegssgfhkvfaegtklivips

Timeline for d1ypzf1:

• d1ypzf1 is new in SCOP 1.75
  
• d1ypzf1 appears in SCOPe 2.01
  
• d1ypzf1 appears in the current release, SCOPe 2.08