![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Human (Homo sapiens), gamma-chain [TaxId:9606] [63651] (3 PDB entries) |
![]() | Domain d1ypzf1: 1ypz F:1-120 [144710] Other proteins in same PDB: d1ypza1, d1ypza2, d1ypzb1, d1ypzc1, d1ypzc2, d1ypzd1, d1ypze2, d1ypzf2, d1ypzg2, d1ypzh2 complexed with fuc, man, nag |
PDB Entry: 1ypz (more details), 3.4 Å
SCOP Domain Sequences for d1ypzf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} hgkleqpeisisrprdetaqisckvfiesfrsvtihwyrqkpnqglefllyvlatpthif ldkeykkmeasknpsastsiltiysleeedeaiyycsygegssgfhkvfaegtklivips
Timeline for d1ypzf1: