![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein T-cell antigen receptor [49125] (6 species) |
![]() | Species Human (Homo sapiens), delta-chain [TaxId:9606] [63662] (2 PDB entries) |
![]() | Domain d1ypze2: 1ypz E:120-207 [144709] Other proteins in same PDB: d1ypza1, d1ypza2, d1ypzb1, d1ypzc1, d1ypzc2, d1ypzd1, d1ypze1, d1ypzf1, d1ypzg1, d1ypzh1 |
PDB Entry: 1ypz (more details), 3.4 Å
SCOPe Domain Sequences for d1ypze2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ypze2 b.1.1.2 (E:120-207) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} sqppakpsvfimkngtnvaclvkdfypkevtislrsskkivefdpaivispsgkysavkl gqygdsnsvtcsvqhnsetvhstdfeaa
Timeline for d1ypze2: