Lineage for d1ynjd1 (1ynj D:3-1240)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574346Family e.29.1.2: RNA-polymerase beta-prime [64490] (4 proteins)
  6. 2574381Protein RNA-polymerase beta-prime [64493] (2 species)
  7. 2574382Species Thermus aquaticus [TaxId:271] [64494] (4 PDB entries)
  8. 2574383Domain d1ynjd1: 1ynj D:3-1240 [144704]
    Other proteins in same PDB: d1ynja1, d1ynja2, d1ynjb1, d1ynjb2, d1ynjc1, d1ynjk1
    protein/RNA complex; complexed with srn, zn

Details for d1ynjd1

PDB Entry: 1ynj (more details), 3.2 Å

PDB Description: Taq RNA polymerase-Sorangicin complex
PDB Compounds: (D:) DNA-directed RNA polymerase beta' chain

SCOPe Domain Sequences for d1ynjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynjd1 e.29.1.2 (D:3-1240) RNA-polymerase beta-prime {Thermus aquaticus [TaxId: 271]}
kevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacgk
ykrqrfegkvcercgvevtrsivrryrmghielatpaahiwfvkdvpskigtlldlsate
leqvlyfnkyivldpkgavldgvpvekrqlltdeeyrelrygkqetyplpagvdalvkdg
eevvkgqelapgvvsrmdgvalyrfprrvrvdylrkeraalriplsawvekeayrpgevl
aelsepylfraeesgvvelkdlaeghliylrqeeevvaryflpagmtplvvegeivevgq
plaegkgllrlprhmtakeveaeeegdsvhltlflewtepkdykvaphmnvivpegakvq
agekivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevttgdrvapgdvla
dggkvkseiygrvevdlvrnvvrvvesydidarmgaeaiqellkeldleklerelleemk
hpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdlnd
lyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtnpgserplrs
ltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkme
ekafapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlve
gqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakps
rdiilglyyitqvrkekkgagmafatpeealaayergevalnapivvagretsvgrlkfv
fanpdeallavahglldlqdvvtvrylgrrletspgrilfarivgeavgdekvaqeliqm
dvpqeknslkdlvyqaflrlgmektarlldalkyygftlsttsgitigiddavipeekqr
yleeadrklrqieqayemgfltdrerydqviqlwtettekvtqavfknfeenypfnplyv
maqsgargnpqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfisshgarkgga
dtalrtadsgyltrklvdvaheivvreadcgttnyisvplfqmdevtrtlrlrkrsdies
glygrvlarevealgrrleegrylsledvhflikaaeagevrevpvrspltcqtrygvcq
kcygydlsmarpvsigeavgvvaaesigepgtqltmrt

SCOPe Domain Coordinates for d1ynjd1:

Click to download the PDB-style file with coordinates for d1ynjd1.
(The format of our PDB-style files is described here.)

Timeline for d1ynjd1: