Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (17 PDB entries) |
Domain d1ymmd1: 1ymm D:9-104 [144702] Other proteins in same PDB: d1ymma1, d1ymma2, d1ymmb1, d1ymmb2, d1ymme2 complexed with nag; mutant |
PDB Entry: 1ymm (more details), 3.5 Å
SCOP Domain Sequences for d1ymmd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} qalsiqegenatmncsyktsinnlqwyrqnsgrglvhlilirsnerekhsgrlrvtldts kksssllitasraadtasyfcatdttsgtykyifgt
Timeline for d1ymmd1: