Lineage for d1yl3v1 (1yl3 V:1-175)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957115Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 957116Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) (S)
  5. 957117Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins)
  6. 957152Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species)
    contains additional all-beta (sub)domain in the C-terminal extension
  7. 957153Species Deinococcus radiodurans [TaxId:1299] [159200] (10 PDB entries)
    Uniprot Q9RX88 1-175
  8. 957160Domain d1yl3v1: 1yl3 V:1-175 [144698]
    Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3w1, d1yl3x1
    automatically matched to 2ZJR S:1-175

Details for d1yl3v1

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (V:) 50S general stress protein CTC (L25)

SCOPe Domain Sequences for d1yl3v1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl3v1 b.53.1.1 (V:1-175) Ribosomal protein TL5 (general stress protein CTC) {Deinococcus radiodurans [TaxId: 1299]}
meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlppr

SCOPe Domain Coordinates for d1yl3v1:

Click to download the PDB-style file with coordinates for d1yl3v1.
(The format of our PDB-style files is described here.)

Timeline for d1yl3v1: