SCOPe 2.05: Domain d1yl371: 1yl3 7:1-46

Lineage for d1yl371 (1yl3 7:1-46)

1. Root: SCOPe 2.05

2. Class j: Peptides [58231] (129 folds)

3. Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
   non-globular, mainly alpha-helical

4. Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family)

5. Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
   Pfam PF00468

6. Protein Ribosomal protein L34p [144323] (3 species)

7. Species Thermus thermophilus [TaxId:274] [161306] (15 PDB entries)
   Uniprot P80340 1-49

8. Domain d1yl371: 1yl3 7:1-46 [144694]
   Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1

Details for d1yl371

PDB Entry: 1yl3, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.

PDB Compounds: (7:) 50S ribosomal protein L34

SCOPe Domain Sequences for d1yl371:

Sequence; same for both SEQRES and ATOM records:

>d1yl371 j.118.1.1 (7:1-46) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]}
mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd

Timeline for d1yl371:

• d1yl371 first appeared in SCOP 1.75
  
• d1yl371 appears in SCOPe 2.04
  
• d1yl371 appears in SCOPe 2.06
  
• d1yl371 appears in the current release, SCOPe 2.08