Lineage for d1yl371 (1yl3 7:1-46)

  1. Root: SCOP 1.75
  2. 899091Class j: Peptides [58231] (121 folds)
  3. 900906Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 900907Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) (S)
  5. 900908Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
    Pfam PF00468
  6. 900909Protein Ribosomal protein L34p [144323] (3 species)
  7. 900910Species Deinococcus radiodurans [TaxId:1299] [161305] (10 PDB entries)
    Uniprot Q9RSH2 1-46
  8. 900917Domain d1yl371: 1yl3 7:1-46 [144694]
    Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1
    automatically matched to 2ZJR 2:1-46

Details for d1yl371

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (7:) 50S ribosomal protein L34

SCOP Domain Sequences for d1yl371:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl371 j.118.1.1 (7:1-46) Ribosomal protein L34p {Deinococcus radiodurans [TaxId: 1299]}
mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd

SCOP Domain Coordinates for d1yl371:

Click to download the PDB-style file with coordinates for d1yl371.
(The format of our PDB-style files is described here.)

Timeline for d1yl371: