Lineage for d1yl331 (1yl3 3:2-85)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2082731Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2083045Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) (S)
    rudiment single hybrid fold with a permuted topology
  5. 2083046Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
    Pfam PF01016
  6. 2083047Protein Ribosomal protein L27 [110326] (3 species)
  7. 2083086Species Thermus thermophilus [TaxId:274] [110327] (6 PDB entries)
    Uniprot P84123
  8. 2083092Domain d1yl331: 1yl3 3:2-85 [144692]
    Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1

Details for d1yl331

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (3:) 50S ribosomal protein L27

SCOPe Domain Sequences for d1yl331:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl331 b.84.4.1 (3:2-85) Ribosomal protein L27 {Thermus thermophilus [TaxId: 274]}
ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
lsdgkvvfinkgkgarfisieaaq

SCOPe Domain Coordinates for d1yl331:

Click to download the PDB-style file with coordinates for d1yl331.
(The format of our PDB-style files is described here.)

Timeline for d1yl331: