Class b: All beta proteins [48724] (174 folds) |
Fold b.155: L21p-like [141090] (1 superfamily) core: sandwich, 6 strands in 2 sheets |
Superfamily b.155.1: L21p-like [141091] (1 family) automatically mapped to Pfam PF00829 |
Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein) Pfam PF00829 |
Protein Ribosomal protein L21p [141093] (3 species) |
Species Thermus thermophilus [TaxId:274] [158939] (15 PDB entries) Uniprot P60492 1-101 |
Domain d1yl321: 1yl3 2:5-98 [144691] Other proteins in same PDB: d1yl301, d1yl311, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1 automatically matched to 2ZJR O:5-98 |
PDB Entry: 1yl3 (more details), 5.5 Å
SCOPe Domain Sequences for d1yl321:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yl321 b.155.1.1 (2:5-98) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]} iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg rgkkiyirkyksgvqyrrrtghrqnftaikilgi
Timeline for d1yl321:
View in 3D Domains from other chains: (mouse over for more information) d1yl301, d1yl311, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1 |