Lineage for d1yl321 (1yl3 2:5-98)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1336451Fold b.155: L21p-like [141090] (1 superfamily)
    core: sandwich, 6 strands in 2 sheets
  4. 1336452Superfamily b.155.1: L21p-like [141091] (1 family) (S)
    automatically mapped to Pfam PF00829
  5. 1336453Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
    Pfam PF00829
  6. 1336454Protein Ribosomal protein L21p [141093] (3 species)
  7. 1336490Species Thermus thermophilus [TaxId:274] [158939] (15 PDB entries)
    Uniprot P60492 1-101
  8. 1336502Domain d1yl321: 1yl3 2:5-98 [144691]
    Other proteins in same PDB: d1yl301, d1yl311, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1
    automatically matched to 2ZJR O:5-98

Details for d1yl321

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (2:) 50S ribosomal protein L21

SCOPe Domain Sequences for d1yl321:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl321 b.155.1.1 (2:5-98) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]}
iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg
rgkkiyirkyksgvqyrrrtghrqnftaikilgi

SCOPe Domain Coordinates for d1yl321:

Click to download the PDB-style file with coordinates for d1yl321.
(The format of our PDB-style files is described here.)

Timeline for d1yl321: