Lineage for d1ykol1 (1yko L:301-538)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790808Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 790809Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
    sandwich; 9 strands in 2 sheets
  6. 790969Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 790987Species Pseudomonas putida [TaxId:303] [49490] (21 PDB entries)
  8. 791107Domain d1ykol1: 1yko L:301-538 [144683]
    Other proteins in same PDB: d1ykoa1, d1ykoc1, d1ykoe1, d1ykog1, d1ykoi1, d1ykok1
    automatically matched to 1YKO B:301-538
    complexed with fe; mutant

Details for d1ykol1

PDB Entry: 1yko (more details), 2.54 Å

PDB Description: protocatechuate 3,4-dioxygenase y408h mutant
PDB Compounds: (L:) protocatechuate 3,4-dioxygenase beta chain

SCOP Domain Sequences for d1ykol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykol1 b.3.6.1 (L:301-538) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrhrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc

SCOP Domain Coordinates for d1ykol1:

Click to download the PDB-style file with coordinates for d1ykol1.
(The format of our PDB-style files is described here.)

Timeline for d1ykol1: