Lineage for d1ykml_ (1ykm L:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2379685Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2379686Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2379895Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 2379910Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries)
  8. 2379946Domain d1ykml_: 1ykm L: [144671]
    Other proteins in same PDB: d1ykma_, d1ykmc_, d1ykme_, d1ykmg_, d1ykmi_, d1ykmk_
    automated match to d1ykmb1
    complexed with fe; mutant

Details for d1ykml_

PDB Entry: 1ykm (more details), 2.22 Å

PDB Description: protocatechuate 3,4-dioxygenase y408e mutant
PDB Compounds: (L:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d1ykml_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykml_ b.3.6.1 (L:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrerhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc

SCOPe Domain Coordinates for d1ykml_:

Click to download the PDB-style file with coordinates for d1ykml_.
(The format of our PDB-style files is described here.)

Timeline for d1ykml_: