Lineage for d1ykkb1 (1ykk B:301-538)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2364769Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2365897Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2365898Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2366107Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 2366122Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries)
  8. 2366213Domain d1ykkb1: 1ykk B:301-538 [144654]
    Other proteins in same PDB: d1ykka_, d1ykkc_, d1ykke_, d1ykkg_, d1ykki_, d1ykkk_
    complexed with fe; mutant

Details for d1ykkb1

PDB Entry: 1ykk (more details), 2.06 Å

PDB Description: Protocatechuate 3,4-Dioxygenase Y408C Mutant
PDB Compounds: (B:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d1ykkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykkb1 b.3.6.1 (B:301-538) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrcrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc

SCOPe Domain Coordinates for d1ykkb1:

Click to download the PDB-style file with coordinates for d1ykkb1.
(The format of our PDB-style files is described here.)

Timeline for d1ykkb1: