Lineage for d1yjwg1 (1yjw G:12-73)

  1. Root: SCOPe 2.01
  2. 1072259Class j: Peptides [58231] (120 folds)
  3. 1073736Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 1073737Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 1073738Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 1073739Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 1073740Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 1073759Domain d1yjwg1: 1yjw G:12-73 [144653]
    Other proteins in same PDB: d1yjw11, d1yjw21, d1yjw31, d1yjwa1, d1yjwa2, d1yjwb1, d1yjwc1, d1yjwd1, d1yjwe1, d1yjwe2, d1yjwf1, d1yjwh1, d1yjwi1, d1yjwj1, d1yjwk1, d1yjwl1, d1yjwm1, d1yjwn1, d1yjwo1, d1yjwp1, d1yjwq1, d1yjwr1, d1yjws1, d1yjwt1, d1yjwu1, d1yjwv1, d1yjww1, d1yjwx1, d1yjwy1, d1yjwz1
    automatically matched to 1VQ4 G:12-73
    complexed with cd, cl, k, mg, na; mutant

Details for d1yjwg1

PDB Entry: 1yjw (more details), 2.9 Å

PDB Description: crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (G:) Acidic ribosomal protein P0 homolog

SCOPe Domain Sequences for d1yjwg1:

Sequence, based on SEQRES records: (download)

>d1yjwg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1yjwg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOPe Domain Coordinates for d1yjwg1:

Click to download the PDB-style file with coordinates for d1yjwg1.
(The format of our PDB-style files is described here.)

Timeline for d1yjwg1: