Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein CD28 [158865] (1 species) T-cell-specific surface glycoprotein |
Species Human (Homo sapiens) [TaxId:9606] [158866] (1 PDB entry) Uniprot P10747 19-136 |
Domain d1yjdc1: 1yjd C:1-118 [144649] Other proteins in same PDB: d1yjdh1, d1yjdl1, d1yjdl2 complexed with nag |
PDB Entry: 1yjd (more details), 2.7 Å
SCOPe Domain Sequences for d1yjdc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} nkilvkqspmlvaydnavnlsckysynlfsrefraslhkgldsavevcvvygnysqqlqv ysktgfncdgklgnesvtfylqnlyvnqtdiyfckievmypppyldneksngtiihvk
Timeline for d1yjdc1: