Lineage for d1yjdc1 (1yjd C:1-118)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929390Protein CD28 [158865] (1 species)
    T-cell-specific surface glycoprotein
  7. 929391Species Human (Homo sapiens) [TaxId:9606] [158866] (1 PDB entry)
    Uniprot P10747 19-136
  8. 929392Domain d1yjdc1: 1yjd C:1-118 [144649]
    Other proteins in same PDB: d1yjdh1
    complexed with nag

Details for d1yjdc1

PDB Entry: 1yjd (more details), 2.7 Å

PDB Description: crystal structure of human cd28 in complex with the fab fragment of a mitogenic antibody (5.11a1)
PDB Compounds: (C:) T-cell-specific surface glycoprotein CD28

SCOPe Domain Sequences for d1yjdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]}
nkilvkqspmlvaydnavnlsckysynlfsrefraslhkgldsavevcvvygnysqqlqv
ysktgfncdgklgnesvtfylqnlyvnqtdiyfckievmypppyldneksngtiihvk

SCOPe Domain Coordinates for d1yjdc1:

Click to download the PDB-style file with coordinates for d1yjdc1.
(The format of our PDB-style files is described here.)

Timeline for d1yjdc1: