SCOPe 2.05: Domain d1yihb1: 1yih B:1-146

Lineage for d1yihb1 (1yih B:1-146)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (225 PDB entries)
   Uniprot P68871

8. Domain d1yihb1: 1yih B:1-146 [144640]
   Other proteins in same PDB: d1yiha_, d1yihc_
   complexed with hem, oxy

Details for d1yihb1

PDB Entry: 1yih, 2 Å

PDB Description: t-to-t(high) quaternary transitions in human hemoglobin: betap100a oxy (2.2mm ihp, 20% peg) (1 test set)

PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1yihb1:

Sequence; same for both SEQRES and ATOM records:

>d1yihb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdaenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1yihb1:

• d1yihb1 first appeared in SCOP 1.75
  
• d1yihb1 appears in SCOPe 2.04
  
• d1yihb1 appears in SCOPe 2.06
  
• d1yihb1 appears in the current release, SCOPe 2.08