| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) ![]() interrupted alpha-helix |
| Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein) |
| Protein Ribosomal protein L39e [48664] (1 species) |
| Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries) Uniprot P22452 |
| Domain d1yi221: 1yi2 2:1-49 [144638] Other proteins in same PDB: d1yi211, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2f1, d1yi2g1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2y1, d1yi2z1 automatically matched to 1VQ4 2:1-49 complexed with cd, cl, ery, k, mg, na; mutant |
PDB Entry: 1yi2 (more details), 2.65 Å
SCOPe Domain Sequences for d1yi221:
Sequence, based on SEQRES records: (download)
>d1yi221 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde
>d1yi221 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde
Timeline for d1yi221:
View in 3DDomains from other chains: (mouse over for more information) d1yi211, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2f1, d1yi2g1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2y1, d1yi2z1 |