Lineage for d1yhqg1 (1yhq G:12-73)

  1. Root: SCOPe 2.06
  2. 2271421Class j: Peptides [58231] (133 folds)
  3. 2272904Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 2272905Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 2272906Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 2272907Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 2272908Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 2272912Domain d1yhqg1: 1yhq G:12-73 [144637]
    Other proteins in same PDB: d1yhq11, d1yhq21, d1yhq31, d1yhqa1, d1yhqa2, d1yhqb1, d1yhqc1, d1yhqd1, d1yhqe1, d1yhqe2, d1yhqf1, d1yhqh1, d1yhqi1, d1yhqj1, d1yhqk1, d1yhql1, d1yhqm1, d1yhqn1, d1yhqo1, d1yhqp1, d1yhqq1, d1yhqr1, d1yhqs1, d1yhqt1, d1yhqu1, d1yhqv1, d1yhqw1, d1yhqx1, d1yhqy1, d1yhqz1
    automatically matched to 1VQ4 G:12-73
    complexed with cd, cl, k, mg, na, sr, zit; mutant

Details for d1yhqg1

PDB Entry: 1yhq (more details), 2.4 Å

PDB Description: crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (G:) Acidic ribosomal protein P0 homolog

SCOPe Domain Sequences for d1yhqg1:

Sequence, based on SEQRES records: (download)

>d1yhqg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1yhqg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOPe Domain Coordinates for d1yhqg1:

Click to download the PDB-style file with coordinates for d1yhqg1.
(The format of our PDB-style files is described here.)

Timeline for d1yhqg1: