Lineage for d1yhnb1 (1yhn B:244-308)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2645275Superfamily h.1.34: RILP dimerisation region [161256] (1 family) (S)
  5. 2645276Family h.1.34.1: RILP dimerisation region [161257] (1 protein)
  6. 2645277Protein Rab-interacting lysosomal protein RLIP [161258] (1 species)
  7. 2645278Species Human (Homo sapiens) [TaxId:9606] [161259] (1 PDB entry)
    Uniprot Q96NA2 244-308
  8. 2645279Domain d1yhnb1: 1yhn B:244-308 [144635]
    Other proteins in same PDB: d1yhna_
    complexed with gtp, mg

Details for d1yhnb1

PDB Entry: 1yhn (more details), 3 Å

PDB Description: structure basis of rilp recruitment by rab7
PDB Compounds: (B:) Rab interacting lysosomal protein

SCOPe Domain Sequences for d1yhnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhnb1 h.1.34.1 (B:244-308) Rab-interacting lysosomal protein RLIP {Human (Homo sapiens) [TaxId: 9606]}
sreefeqilqernelkakvfllkeelayfqrelltdhrvpsllleamkvavrkqrkkika
kmlgt

SCOPe Domain Coordinates for d1yhnb1:

Click to download the PDB-style file with coordinates for d1yhnb1.
(The format of our PDB-style files is described here.)

Timeline for d1yhnb1: