SCOPe 2.08: Domain d1yhnb1: 1yhn B:244-308

Lineage for d1yhnb1 (1yhn B:244-308)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.34: RILP dimerisation region [161256] (1 family)

5. Family h.1.34.1: RILP dimerisation region [161257] (1 protein)

6. Protein Rab-interacting lysosomal protein RLIP [161258] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161259] (1 PDB entry)
   Uniprot Q96NA2 244-308

8. Domain d1yhnb1: 1yhn B:244-308 [144635]
   Other proteins in same PDB: d1yhna_
   complexed with gtp, mg

Details for d1yhnb1

PDB Entry: 1yhn, 3 Å

PDB Description: structure basis of rilp recruitment by rab7

PDB Compounds: (B:) Rab interacting lysosomal protein

SCOPe Domain Sequences for d1yhnb1:

Sequence; same for both SEQRES and ATOM records:

>d1yhnb1 h.1.34.1 (B:244-308) Rab-interacting lysosomal protein RLIP {Human (Homo sapiens) [TaxId: 9606]}
sreefeqilqernelkakvfllkeelayfqrelltdhrvpsllleamkvavrkqrkkika
kmlgt

Timeline for d1yhnb1:

• d1yhnb1 first appeared in SCOP 1.75
  
• d1yhnb1 appears in SCOPe 2.07