![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
![]() | Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
![]() | Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
![]() | Protein Hypothetical protein YkuL [117881] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [117882] (1 PDB entry) Uniprot O31698 9-142 |
![]() | Domain d1yavb3: 1yav B:13-144 [144630] Structural genomics target complexed with so4 |
PDB Entry: 1yav (more details), 2.1 Å
SCOPe Domain Sequences for d1yavb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yavb3 d.37.1.1 (B:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} eatvgqfmieadkvahvqvgnnlehallvltktgytaipvldpsyrlhgligtnmimnsi fgleriefekldqitveevmltdiprlhindpimkgfgmvinngfvcvendeqvfegift rrvvlkelnkhi
Timeline for d1yavb3: